This post is by a banned member (tempuser12) - Unhide
03 February, 2022 - 10:43 PM
Reply
This post is by a banned member (lfreakshowl) - Unhide
04 February, 2022 - 08:29 AM
Reply
[font][font]thanx[/font][/font]
This post is by a banned member (olsughgru) - Unhide
04 February, 2022 - 11:36 AM
Reply
(25 January, 2022 - 06:25 AM)SimplyCxlaa Wrote: Show MoreContains:
1) RDP Cracking
1) RDP into and how to get valid CC Free
2) how to get free RDP
3) How Developer get Free RDP
4) How to crack RDP using Tools
5) Crack RDP using angry IP scanner 100%
6) Get free 6GB RDP, free hosting, free domain
7) clear small dout of RDP
8) Why RDP is important for cracking
2) How to make own combos using SQL dumper, tps dork generator, EZ dork searcher
1) how to get free proxy and keywords
2) how to generate dork and search dork
3) How to import links on SQL Dumper
4) How to Find Exploitable site and How to Find injectable site using SQL Dumper
5) How to get own Combos and email list
6) How to export combos and email list on Desktop
3) How to make combos using slayer leecher
How to Make HQ combos using slayer leecher
4) How to make own HQ Proxy
1) How to check proxy
2) How to make own proxy and check
5) Premium account cracking
1) Minicraft cracking
2) Nord VPN cracking
3) Netflix account cracking
6) How to use open bullet
7) SMTP cracking
8) Facebook account cracking
9) MD5 Decrypter
yes daddy
This post is by a banned member (mrflasher) - Unhide
04 February, 2022 - 01:54 PM
Reply
makldmldmlqewkmdlwedmwelmdlwemdlwemfewlfwe'f
This post is by a banned member (ricardsgulbis) - Unhide
04 February, 2022 - 02:55 PM
Reply
wow thats alot of thing im going to try
This post is by a banned member (Drakzz) - Unhide
04 February, 2022 - 04:51 PM
Reply
(25 January, 2022 - 06:25 AM)SimplyCxlaa Wrote: Show MoreContains:
1) RDP Cracking
1) RDP into and how to get valid CC Free
2) how to get free RDP
3) How Developer get Free RDP
4) How to crack RDP using Tools
5) Crack RDP using angry IP scanner 100%
6) Get free 6GB RDP, free hosting, free domain
7) clear small dout of RDP
8) Why RDP is important for cracking
2) How to make own combos using SQL dumper, tps dork generator, EZ dork searcher
1) how to get free proxy and keywords
2) how to generate dork and search dork
3) How to import links on SQL Dumper
4) How to Find Exploitable site and How to Find injectable site using SQL Dumper
5) How to get own Combos and email list
6) How to export combos and email list on Desktop
3) How to make combos using slayer leecher
How to Make HQ combos using slayer leecher
4) How to make own HQ Proxy
1) How to check proxy
2) How to make own proxy and check
5) Premium account cracking
1) Minicraft cracking
2) Nord VPN cracking
3) Netflix account cracking
6) How to use open bullet
7) SMTP cracking
8) Facebook account cracking
9) MD5 Decrypter

finakllly
This post is by a banned member (hhipemd) - Unhide
05 February, 2022 - 04:08 AM
Reply
This post is by a banned member (jitgritz) - Unhide
05 February, 2022 - 04:45 AM
Reply
Lets try this thanks for sharing my boy